project y biotech bpc-157

project y biotech bpc-157 Buy (10mg) BPC-157 (10mg/vial) – Genepro Biotech

Name: project y biotech bpc-157 Buy (10mg) BPC-157 (10mg/vial) – Genepro Biotech
Brand: crisbcreativa.com
SKU: 82412695176
Price: 25.70 USD
Availability: InStock
Rating: 4.297000000000001 (8 reviews)

BPC 157 (10mg vial) Genepro Biotech BPC 157 Precision Performance Physical Therapy BPC 157 Vial BioHack London BioHack London biotech peptides bpc 157 Peptide: Enhance Healing and Recovery Desert Mobile Medical BPC 157 Echelon BioTech Multifunctionality and Possible Medical Application of the BPC 157 PeptideLiterature and Patent Review

SKU: 82412695176 · From crisbcreativa.com

4.3

USD25.70 USD65.70

Pay in 4 interest-free payments of $6.42 Learn more

Shipping Estimate
USA

USA

CAN

Ships within 48 hours · Estimated delivery Aug 1 - Aug 6

Description

DSIP 10mg is provided in lyophilized powder form and intended solely for laboratory research and analytical purposes

While this does not directly affect the peptide chemistry, it is good practice to store medications in a clean, dedicated area of the refrigerator

CAS Number : 1415456-99-3 Chemical Formula : CHNOS Molecular Weight : 4408.258 g/mol Sequence : XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP What are the key features of Cagrilintide (10mg)